Back to Google DeepMind
Google DeepMind /

G
VaultGemma 1B

Open WeightsSpecializedtextUpdated September 13, 2025

VaultGemma 1B

Model Overview

VaultGemma 1B is a groundbreaking 1-billion parameter open-weights model developed by Google DeepMind, released on September 13, 2025. Based on the Gemma 2 architecture, it is notable for being the first language model of its scale to be fully trained from scratch using Differential Privacy (DP). VaultGemma is engineered specifically to prevent the memorization and leakage of sensitive training data, offering a mathematically proven approach to data privacy.

Capabilities

VaultGemma 1B's architecture (26 layers, 1,024-token context window) is paired with state-of-the-art privacy mechanisms:

  • Differentially Private Stochastic Gradient Descent (DP-SGD): Ensures that the model’s outputs remain statistically indistinguishable regardless of whether any specific individual data point was included in the training set.
  • Guaranteed Anti-Memorization: Provides mathematical guarantees preventing the regurgitation or leakage of sensitive training data.
  • Lightweight & Local: Its 1B parameter size makes it extremely lightweight, perfectly suited for resource-constrained local devices and edge computing.

Example Use Cases

VaultGemma is ideal for highly regulated industries where handling confidential or personally identifiable information (PII) is a priority:

  • Healthcare: Processing sensitive patient queries or medical texts without risking the exposure of underlying training data.
  • Finance: Analyzing financial records, customer data, and compliance documents locally.
  • Legal Services: Reviewing confidential legal contracts and case files in a secure, self-hosted environment.
  • On-Device AI: Running privacy-first AI assistants directly on consumer devices (e.g., smartphones, laptops).

Performance & Benchmarks

A significant breakthrough of VaultGemma 1B is its establishment of new "scaling laws for differentially private language models," proving that utility can be maintained while enforcing strict privacy:

  • Privacy Bounds: Achieved strong mathematical privacy bounds of ε (epsilon) ≤ 2.0 and δ (delta) ≤ 1.1 × 10⁻¹⁰ at the sequence level.
  • Utility: Demonstrates competitive text generation capabilities for a 1B model, successfully balancing the trade-offs between compute, privacy, and utility.

Intended Use & Limitations

  • Secure Deployments: Intended for self-hostable, local deployments where strict data compliance is required.
  • Context Window: Features a relatively small 1,024-token context window (though metadata lists 8k, architectural reports note 1k limitations), which may restrict the length of documents it can process at one time.
  • Licensing: Available as an open-weights model under the Gemma Terms of Use.

About Google DeepMind

Google DeepMind is a premier AI research organization committed to building safe and capable AI systems. By developing models like VaultGemma, DeepMind is advancing the field of privacy-preserving machine learning, ensuring that the benefits of large language models can be safely deployed in sensitive, high-stakes environments without compromising user data.

Key Features

Trained from scratch using Differential Privacy (DP) training pipelines

Feature 01

Provides mathematical guarantees preventing training data memorization and leaks

Feature 02

Extremely lightweight 1B size suitable for resource-constrained local devices

Feature 03

Ideal for sensitive domains like finance, law, or healthcare requiring strict data compliance

Feature 04

You might also want to compare

Verified Sources

Tags

privacydifferential-privacylightweightopen-weights

Model Specs

open-weights

Parameters

1B

Context Window

8k

License

Gemma Terms of Use

Deployment

self-hostable

Resources & Links

Curator Notes

Registered VaultGemma 1B. Released on Sept 13, 2025. Specialized differentially private model trained from scratch.

Compare Specs

Compare parameters, context windows, modalities, and benchmark scores of this model side-by-side with others.

Compare Model